| ID | DRAMP03004 |
|---|---|
| Sequence | FVPYNPPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH |
| Length | 39 |
| Name | Abaecin (Insects, animals) |
| Source | Bombus pascuorum (Brown bumblebee) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacteria: Micrococcus luteus;##Gram-negative bacteria: Escherichia coli D22. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P81463 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9219367 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | FVPYNPPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH |
| Molecular Weight | 4394.946 |
| Grand Average of Hydropathy | -1.026 |
| Isoelectric Point | 9.997 |
| Charge at pH 7.4 | 2.621 |
| Secondary Structure | Helix: 0.256, Turn: 0.564, Sheet: 0.026 |
| Instability Index | 57.703 |
| Aromaticity | 0.179 |
