| ID | DRAMP03069 |
|---|---|
| Sequence | DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK |
| Length | 37 |
| Name | Diptericin (Insects, animals) |
| Source | Sarcophaga peregrina (Flesh fly) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Escherichia coli (MIC=6.25 µg/ml), Shigella sonnei (MIC=12.5 µg/ml). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q9TWW2 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 1445217 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK |
| Molecular Weight | 3928.281 |
| Grand Average of Hydropathy | -1.011 |
| Isoelectric Point | 6.748 |
| Charge at pH 7.4 | -0.415 |
| Secondary Structure | Helix: 0.216, Turn: 0.459, Sheet: 0.081 |
| Instability Index | 79.816 |
| Aromaticity | 0.054 |