| ID | DRAMP03071 |
|---|---|
| Sequence | DEKPKLILPTPAPPNLPQLVGGGGGNRKDGFGVSVDAHQKVWTSDNGGHSIGVSPGYSQHLPGPYGNSRPDYRIGAGYSYNF |
| Length | 82 |
| Name | Diptericin-A (Insects, animals) |
| Source | Protophormia terraenovae (Northern blowfly) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacterium: Escherichia coli. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P10836 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 3276515 |
Physicochemical Properties
| Residues | 82 |
|---|---|
| Sequence | DEKPKLILPTPAPPNLPQLVGGGGGNRKDGFGVSVDAHQKVWTSDNGGHSIGVSPGYSQHLPGPYGNSRPDYRIGAGYSYNF |
| Molecular Weight | 8619.374 |
| Grand Average of Hydropathy | -0.727 |
| Isoelectric Point | 8.264 |
| Charge at pH 7.4 | 0.648 |
| Secondary Structure | Helix: 0.256, Turn: 0.451, Sheet: 0.110 |
| Instability Index | 27.011 |
| Aromaticity | 0.098 |