| ID | DRAMP03117 |
|---|---|
| Sequence | QSEAGWLKKIGKKIERVGQHTRDATIQGLGVAQQAPNVAATAR |
| Length | 43 |
| Name | Drosophila cecropin-A1 (Insects, animals) |
| Source | Drosophila simulans (Fruit fly) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-negative bacteria: Alcaligenes faecalis (MIC=10-25 µM), Escherichia coli 1106 (MIC=0.25-0.5 µM), Escherichia coli D22 (MIC=0.1-0.25 µM), Escherichia coli D31 (MIC=0.1-0.25 µM), Escherichia coli SBS363 (MIC=0.1-0.25 µM), Enterobacter cloacae β12 (MIC=0.5-1 µM), Erwinia carotovora (MIC=0.5-1 µM), Klebsiella pneumoniae (MIC=1-2.5 µM), Pseudomonas aeruginosa (MIC=1-2.5 µM), Salmonella typhimurium (MIC=0.5-1 µM), Xanthomonas campestris (MIC=0.5-1 µM); ##Gram-positive bacteria: Aerococcus viridans (MIC=5-10 µM), Bacillus megaterium (MIC=1-2.5 µM), Micrococcus luteus (MIC=5-10 µM).##Fungi: Botrytis cinerea (MIC=5-10 µM), Fusarium culmorum (MIC=1-2.5 µM), Fusarium oxysporum (MIC=1-2.5 µM), Neurospora crassa (MIC=2.5-10 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O61272 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9553148, 9725836 |
Physicochemical Properties
| Residues | 43 |
|---|---|
| Sequence | QSEAGWLKKIGKKIERVGQHTRDATIQGLGVAQQAPNVAATAR |
| Molecular Weight | 4584.162 |
| Grand Average of Hydropathy | -0.579 |
| Isoelectric Point | 10.433 |
| Charge at pH 7.4 | 3.587 |
| Secondary Structure | Helix: 0.209, Turn: 0.186, Sheet: 0.256 |
| Instability Index | 37.756 |
| Aromaticity | 0.023 |