| ID | DRAMP03184 |
|---|---|
| Sequence | SVIGCEICEWLVATAEGFVNKTKPQIEQELLQICAKLGPYEQICDQLVLMELPDIIDQIIAKEPPAIVCSQVKICNG |
| Length | 77 |
| Name | Naegleriapore B |
| Source | Naegleria fowleri (Brain eating amoeba) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiprotozoal, Cytotoxic |
| Pathogen | Gram-negative bacterium: Escherichia coli K-12 D31;##Gram-positive bacterium: Bacillus subtilis strain 60015. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q95X02 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11948186 |
Physicochemical Properties
| Residues | 77 |
|---|---|
| Sequence | SVIGCEICEWLVATAEGFVNKTKPQIEQELLQICAKLGPYEQICDQLVLMELPDIIDQIIAKEPPAIVCSQVKICNG |
| Molecular Weight | 8485.927 |
| Grand Average of Hydropathy | 0.334 |
| Isoelectric Point | 4.286 |
| Charge at pH 7.4 | -6.899 |
| Secondary Structure | Helix: 0.351, Turn: 0.169, Sheet: 0.273 |
| Instability Index | 40.5 |
| Aromaticity | 0.039 |