| ID | DRAMP03383 |
|---|---|
| Sequence | GKNPILQCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYVRISLTGVDDNTNWSYEKHWPRIP |
| Length | 64 |
| Name | Beta-defensin 19 (BD-19, mBD-19; Defensin, beta 19; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8K3I8, Q3V0L7 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12128228 |
Physicochemical Properties
| Residues | 64 |
|---|---|
| Sequence | GKNPILQCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYVRISLTGVDDNTNWSYEKHWPRIP |
| Molecular Weight | 7547.597 |
| Grand Average of Hydropathy | -0.645 |
| Isoelectric Point | 9.058 |
| Charge at pH 7.4 | 4.43 |
| Secondary Structure | Helix: 0.266, Turn: 0.266, Sheet: 0.125 |
| Instability Index | 48.185 |
| Aromaticity | 0.141 |