| ID | DRAMP03384 |
|---|---|
| Sequence | KRCFSNVEGYCRKKCRLVEISEMGCLHGKYCCVNELENKKHKKHSVVEETVKLQDKSKVQDYMILPTVTYYTISI |
| Length | 75 |
| Name | Beta-defensin 20 (BD-20, mBD-20; Defensin, beta 20; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KP3, Q8C5A7 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 75 |
|---|---|
| Sequence | KRCFSNVEGYCRKKCRLVEISEMGCLHGKYCCVNELENKKHKKHSVVEETVKLQDKSKVQDYMILPTVTYYTISI |
| Molecular Weight | 8804.251 |
| Grand Average of Hydropathy | -0.519 |
| Isoelectric Point | 8.934 |
| Charge at pH 7.4 | 4.489 |
| Secondary Structure | Helix: 0.307, Turn: 0.160, Sheet: 0.187 |
| Instability Index | 44.005 |
| Aromaticity | 0.08 |