| ID | DRAMP03403 |
|---|---|
| Sequence | AGANDLCQECEDIVHLLTKMTKEDAFQDTIRKFLEQECDILPLKLLVPRCRQVLDVYLPLVIDYFQGQIKPKAICSHVGLC |
| Length | 81 |
| Name | SP-BN (N-terminal region of Surfactant Protein B; SAPLIP; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 20007532 |
Physicochemical Properties
| Residues | 81 |
|---|---|
| Sequence | AGANDLCQECEDIVHLLTKMTKEDAFQDTIRKFLEQECDILPLKLLVPRCRQVLDVYLPLVIDYFQGQIKPKAICSHVGLC |
| Molecular Weight | 9247.804 |
| Grand Average of Hydropathy | 0.091 |
| Isoelectric Point | 5.184 |
| Charge at pH 7.4 | -3.477 |
| Secondary Structure | Helix: 0.358, Turn: 0.111, Sheet: 0.272 |
| Instability Index | 40.13 |
| Aromaticity | 0.062 |