| ID | DRAMP03462 |
|---|---|
| Sequence | ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE |
| Length | 88 |
| Name | Protein S100-A8 (Calgranulin-A; MRP-8; Rodents, mammals, animals) |
| Source | Rattus norvegicus (Rat) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P50115 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 21487906 |
Physicochemical Properties
| Residues | 88 |
|---|---|
| Sequence | ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE |
| Molecular Weight | 10107.196 |
| Grand Average of Hydropathy | -0.485 |
| Isoelectric Point | 5.689 |
| Charge at pH 7.4 | -4.244 |
| Secondary Structure | Helix: 0.318, Turn: 0.193, Sheet: 0.261 |
| Instability Index | 39.142 |
| Aromaticity | 0.091 |