| ID | DRAMP03485 |
|---|---|
| Sequence | WNPFKELERAGQRVRDAVISAAAVATVGQAAAIARGG |
| Length | 37 |
| Name | Bactericidin B-5P (Cecropin-like peptide B-5; Insects, animals) |
| Source | Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P14665 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 3143727 |
Physicochemical Properties
| Residues | 37 |
|---|---|
| Sequence | WNPFKELERAGQRVRDAVISAAAVATVGQAAAIARGG |
| Molecular Weight | 3808.268 |
| Grand Average of Hydropathy | 0.051 |
| Isoelectric Point | 10.667 |
| Charge at pH 7.4 | 1.558 |
| Secondary Structure | Helix: 0.243, Turn: 0.189, Sheet: 0.351 |
| Instability Index | 12.176 |
| Aromaticity | 0.054 |