| ID | DRAMP03490 |
|---|---|
| Sequence | VFGTLGSTDDSLFGRYKQDIFNDHRGHLQGQAYGSR |
| Length | 36 |
| Name | Gloverin (Insects, animals) |
| Source | Heliothis virescens (Tobacco budworm moth) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P86358 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | VFGTLGSTDDSLFGRYKQDIFNDHRGHLQGQAYGSR |
| Molecular Weight | 4044.318 |
| Grand Average of Hydropathy | -0.842 |
| Isoelectric Point | 6.894 |
| Charge at pH 7.4 | -0.409 |
| Secondary Structure | Helix: 0.278, Turn: 0.278, Sheet: 0.111 |
| Instability Index | 32.225 |
| Aromaticity | 0.139 |