| ID | DRAMP03526 |
|---|---|
| Sequence | EIRLPEPFRFPSPTVPKPIDIDPILPHPWSPRQTYPIIARRS |
| Length | 42 |
| Name | Proline-rich antimicrobial peptide 2 (Insects, animals) |
| Source | Galleria mellonella (Greater wax moth) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacterium: Micrococcus luteus (MIC=8.6 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P85212 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17194500 |
Physicochemical Properties
| Residues | 42 |
|---|---|
| Sequence | EIRLPEPFRFPSPTVPKPIDIDPILPHPWSPRQTYPIIARRS |
| Molecular Weight | 4931.695 |
| Grand Average of Hydropathy | -0.583 |
| Isoelectric Point | 9.965 |
| Charge at pH 7.4 | 1.701 |
| Secondary Structure | Helix: 0.310, Turn: 0.333, Sheet: 0.119 |
| Instability Index | 102.757 |
| Aromaticity | 0.095 |