| ID | DRAMP03537 |
|---|---|
| Sequence | DLRFWNPREKLPLPTLPPFNPKPIYIDMGNRY |
| Length | 32 |
| Name | Lebocin-4 (Leb 4; Insects, animals) |
| Source | Bombyx mori (Silk moth) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O15946 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9325165 |
Physicochemical Properties
| Residues | 32 |
|---|---|
| Sequence | DLRFWNPREKLPLPTLPPFNPKPIYIDMGNRY |
| Molecular Weight | 3899.521 |
| Grand Average of Hydropathy | -0.825 |
| Isoelectric Point | 9.523 |
| Charge at pH 7.4 | 1.549 |
| Secondary Structure | Helix: 0.344, Turn: 0.344, Sheet: 0.188 |
| Instability Index | 35.481 |
| Aromaticity | 0.156 |