| ID | DRAMP03557 |
|---|---|
| Sequence | GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL |
| Length | 83 |
| Name | Granulysin (Lymphokine LAG-2; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial, Antifungal, Antiparasitic |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P22749 |
| PDB | 1L9L resolved by X-ray. |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9756476, 12488100 |
Physicochemical Properties
| Residues | 83 |
|---|---|
| Sequence | GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL |
| Molecular Weight | 9531.98 |
| Grand Average of Hydropathy | -0.614 |
| Isoelectric Point | 10.553 |
| Charge at pH 7.4 | 10.424 |
| Secondary Structure | Helix: 0.241, Turn: 0.181, Sheet: 0.169 |
| Instability Index | 42.605 |
| Aromaticity | 0.048 |