| ID | DRAMP03610 |
|---|---|
| Sequence | GLGPAEGHCLNLFGVCRTDVCNIVEDQIGACRRRMKCCRAWWILMPIPTPLIMSDYQEPLKPNLK |
| Length | 65 |
| Name | Beta-defensin 109 (Defensin, beta 109; Defensin, beta 109; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KR1 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 65 |
|---|---|
| Sequence | GLGPAEGHCLNLFGVCRTDVCNIVEDQIGACRRRMKCCRAWWILMPIPTPLIMSDYQEPLKPNLK |
| Molecular Weight | 7372.733 |
| Grand Average of Hydropathy | -0.034 |
| Isoelectric Point | 8.327 |
| Charge at pH 7.4 | 1.442 |
| Secondary Structure | Helix: 0.292, Turn: 0.231, Sheet: 0.246 |
| Instability Index | 65.462 |
| Aromaticity | 0.062 |