| ID | DRAMP03624 |
|---|---|
| Sequence | ARLKKCFNKVTGYCRKKCKVGERYEIGCLSGKLCCANDEEEKKHVSFKKPHQHSGEKLSVLQDYIILPTITIFTV |
| Length | 75 |
| Name | Beta-defensin 128 (Beta-defensin 28, DEFB-28; Defensin, beta 128; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q7Z7B8, B2RU29 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11780052, 15489334 |
Physicochemical Properties
| Residues | 75 |
|---|---|
| Sequence | ARLKKCFNKVTGYCRKKCKVGERYEIGCLSGKLCCANDEEEKKHVSFKKPHQHSGEKLSVLQDYIILPTITIFTV |
| Molecular Weight | 8590.035 |
| Grand Average of Hydropathy | -0.449 |
| Isoelectric Point | 9.239 |
| Charge at pH 7.4 | 6.541 |
| Secondary Structure | Helix: 0.293, Turn: 0.173, Sheet: 0.187 |
| Instability Index | 20.553 |
| Aromaticity | 0.08 |