Basic Information
| ID | DRAMP03635 |
|---|
| Sequence | GRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQA |
|---|
| Length | 48 |
|---|
| Name | Human lactoferricin (LfcinH; one chain of Lactotransferrin; Human, mammals, animals) |
|---|
| Source | Homo sapiens (Human) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
|---|
| Pathogen | Gram-negative bacterium: Escherichia coli serotype O111. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P02788, B7Z4X2, E7EQH5, O00756, Q16780, Q16785, Q16786, Q16789, Q8IU92 |
|---|
| PDB |
1Z6V, 1Z6W |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 15155221, 16048952 |
|---|
