| ID | DRAMP03668 |
|---|---|
| Sequence | YLDVKQLANYLLCIGNGQVFNGRKTCQIGCRAVCQQPGCSGYKECEQIPNIRLHKYRCHCNEA |
| Length | 63 |
| Name | Megourin-1 (arthropod; animals) |
| Source | Megoura viciae (Vetch aphid) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P83417 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 63 |
|---|---|
| Sequence | YLDVKQLANYLLCIGNGQVFNGRKTCQIGCRAVCQQPGCSGYKECEQIPNIRLHKYRCHCNEA |
| Molecular Weight | 7150.218 |
| Grand Average of Hydropathy | -0.429 |
| Isoelectric Point | 8.702 |
| Charge at pH 7.4 | 3.418 |
| Secondary Structure | Helix: 0.270, Turn: 0.222, Sheet: 0.175 |
| Instability Index | 30.992 |
| Aromaticity | 0.079 |