| ID | DRAMP03728 |
|---|---|
| Sequence | GILREKYAHKAIDVLTPMIGVPVVSKIVNNAAKQLVHKIAKNQQLCMFNKDVAGWCEKSCQQSAHQKGYCHGTKCKCGIPLNYK |
| Length | 84 |
| Name | Hg-scorpine-like 2 (Arthropods, animals) |
| Source | Hadrurus gertschi (Scorpion) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | Yeasts |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P0C8W5 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17506894 |
Physicochemical Properties
| Residues | 84 |
|---|---|
| Sequence | GILREKYAHKAIDVLTPMIGVPVVSKIVNNAAKQLVHKIAKNQQLCMFNKDVAGWCEKSCQQSAHQKGYCHGTKCKCGIPLNYK |
| Molecular Weight | 9325.958 |
| Grand Average of Hydropathy | -0.271 |
| Isoelectric Point | 9.482 |
| Charge at pH 7.4 | 8.522 |
| Secondary Structure | Helix: 0.274, Turn: 0.202, Sheet: 0.190 |
| Instability Index | 41.694 |
| Aromaticity | 0.06 |