| ID | DRAMP03749 |
|---|---|
| Sequence | YPASMDNYDDALEELDNLDLDDYFDLEPADFVLLDMWANMLESSDFDDME |
| Length | 50 |
| Name | Peptide BmKa2 (Acidic venom peptide Ka2; NDBP-6.2; Arthropods, animals) |
| Source | Mesobuthus martensii (Manchurian scorpion) (Buthus martensii) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8N0N8 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15062994, 16040157 |
Physicochemical Properties
| Residues | 50 |
|---|---|
| Sequence | YPASMDNYDDALEELDNLDLDDYFDLEPADFVLLDMWANMLESSDFDDME |
| Molecular Weight | 5888.23 |
| Grand Average of Hydropathy | -0.522 |
| Isoelectric Point | 4.05 |
| Charge at pH 7.4 | -18.437 |
| Secondary Structure | Helix: 0.320, Turn: 0.160, Sheet: 0.420 |
| Instability Index | 40 |
| Aromaticity | 0.14 |