Basic Information
| ID | DRAMP03766 |
|---|
| Sequence | GWINEEKIQKKIDEKIGNNILGGMAKAVVHKLAKGEFQCVANIDTMGNCETHCQKTSGEKGFCHGTKCKCGKPLSY |
|---|
| Length | 76 |
|---|
| Name | Heteroscorpine-1 (HS-1; defensins; Arthropods, animals) |
|---|
| Source | Heterometrus laoticus (Thai giant scorpion) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | Gram-positive bacterium: Bacillus subtilis (5.2 mm);##Gram-negative bacteria: Klebsiella pneumoniae (10.57 mm), Pseudomonas aeruginosa (6.4 mm).##NOTE: Diameter of clear zone from disc diffusion assay. Total protein is 6.25 µmole. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P0C2F4 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 17056081 |
|---|
Physicochemical Properties
| Residues | 76 |
|---|
| Sequence | GWINEEKIQKKIDEKIGNNILGGMAKAVVHKLAKGEFQCVANIDTMGNCETHCQKTSGEKGFCHGTKCKCGKPLSY |
|---|
| Molecular Weight | 8298.562 |
|---|
| Grand Average of Hydropathy | -0.553 |
|---|
| Isoelectric Point | 8.792 |
|---|
| Charge at pH 7.4 | 3.495 |
|---|
| Secondary Structure | Helix: 0.211, Turn: 0.237, Sheet: 0.197 |
|---|
| Instability Index | 19.687 |
|---|
| Aromaticity | 0.053 |
|---|
Similar Structure Search
File for ID DRAMP03766 does not exist.
