| ID | DRAMP03780 |
|---|---|
| Sequence | AIPIAYVGMAVAPQVFRWLVRAYGAAAVTAAGVTLRRVINRSRSNDNHSCYGNRGWCRSSCRSYEREYRGGNLGVCGSYKCCVT |
| Length | 84 |
| Name | Big defensin (AiBD) |
| Source | Argopecten irradians (Bay scallop) (Aequipecten irradians) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q0H293 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16597463 |
Physicochemical Properties
| Residues | 84 |
|---|---|
| Sequence | AIPIAYVGMAVAPQVFRWLVRAYGAAAVTAAGVTLRRVINRSRSNDNHSCYGNRGWCRSSCRSYEREYRGGNLGVCGSYKCCVT |
| Molecular Weight | 9224.462 |
| Grand Average of Hydropathy | -0.14 |
| Isoelectric Point | 9.809 |
| Charge at pH 7.4 | 8.482 |
| Secondary Structure | Helix: 0.286, Turn: 0.274, Sheet: 0.190 |
| Instability Index | 53.379 |
| Aromaticity | 0.107 |