| ID | DRAMP03783 |
|---|---|
| Sequence | QWGYGGMPYGGYGGMGGYGMGGYGMGYRRRMWGSPYGGYGGYGGYGGWG |
| Length | 49 |
| Name | Neuropeptide-like protein 27 (NLP-27; Gly-rich, Tyr-rich; nematodes, animals; Predicted) |
| Source | Caenorhabditis elegans |
| Activity | Antimicrobial, Antibacterial, Antifungal, Antiviral |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15048112 |
Physicochemical Properties
| Residues | 49 |
|---|---|
| Sequence | QWGYGGMPYGGYGGMGGYGMGGYGMGYRRRMWGSPYGGYGGYGGYGGWG |
| Molecular Weight | 5111.582 |
| Grand Average of Hydropathy | -0.751 |
| Isoelectric Point | 9.399 |
| Charge at pH 7.4 | 2.532 |
| Secondary Structure | Helix: 0.265, Turn: 0.551, Sheet: 0.102 |
| Instability Index | 37.039 |
| Aromaticity | 0.265 |