| ID | DRAMP03786 |
|---|---|
| Sequence | QWGYGGYGRGYGGYGGYGRGYGGYGRGYGGYGRGMWGRPYGGYGWGK |
| Length | 47 |
| Name | Neuropeptide-like protein 30 (NLP-30; Gly-rich, Tyr-rich; nematodes, animals; Predicted) |
| Source | Caenorhabditis elegans |
| Activity | Antimicrobial, Antibacterial, Antifungal, Antiviral |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15048112 |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | QWGYGGYGRGYGGYGGYGRGYGGYGRGYGGYGRGMWGRPYGGYGWGK |
| Molecular Weight | 5006.323 |
| Grand Average of Hydropathy | -1.196 |
| Isoelectric Point | 9.849 |
| Charge at pH 7.4 | 5.527 |
| Secondary Structure | Helix: 0.298, Turn: 0.532, Sheet: 0.021 |
| Instability Index | -21.321 |
| Aromaticity | 0.298 |