| ID | DRAMP03787 |
|---|---|
| Sequence | NAQWGYGGYGRGYGGYGGYGRGYGGYGGYGRGYGGYGRGMYGGYGRPYGGYGWGK |
| Length | 55 |
| Name | Neuropeptide-like protein 31 (NLP-31; nematodes, animals) |
| Source | Caenorhabditis elegans |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
| Pathogen | Gram-positive bacterium: Micrococcus luteus;##Gram-negative bacterium: E.coli.##Fungi: D.coniospora. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O44662 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11717458, 15048112 |
Physicochemical Properties
| Residues | 55 |
|---|---|
| Sequence | NAQWGYGGYGRGYGGYGGYGRGYGGYGGYGRGYGGYGRGMYGGYGRPYGGYGWGK |
| Molecular Weight | 5723.018 |
| Grand Average of Hydropathy | -1.136 |
| Isoelectric Point | 9.697 |
| Charge at pH 7.4 | 5.52 |
| Secondary Structure | Helix: 0.291, Turn: 0.545, Sheet: 0.036 |
| Instability Index | -13.805 |
| Aromaticity | 0.291 |