| ID | DRAMP03789 |
|---|---|
| Sequence | EASCARMDVPVMQRIAQGLCTSSCTAQKCMTGICKKVDSHPTCFCGGCSNANDVSLDTLISQLPHN |
| Length | 66 |
| Name | ABF-1 (nematodes, animals) |
| Source | Caenorhabditis elegans |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11772394 |
Physicochemical Properties
| Residues | 66 |
|---|---|
| Sequence | EASCARMDVPVMQRIAQGLCTSSCTAQKCMTGICKKVDSHPTCFCGGCSNANDVSLDTLISQLPHN |
| Molecular Weight | 6978.004 |
| Grand Average of Hydropathy | -0.024 |
| Isoelectric Point | 6.925 |
| Charge at pH 7.4 | -0.461 |
| Secondary Structure | Helix: 0.182, Turn: 0.258, Sheet: 0.197 |
| Instability Index | 47.083 |
| Aromaticity | 0.015 |