| ID | DRAMP03791 |
|---|---|
| Sequence | QWGYNSYGYGNYGGYGGYPMYGGYGMNGGYGGGGLLGMFLGKKK |
| Length | 44 |
| Name | Caenacin-1 (Gly-rich, Tyr-rich; CNC-1; nematode, invertebrate, animals) |
| Source | Caenorhabditis elegans |
| Activity | Antimicrobial, Antibacterial, Antifungal, Antiviral |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15048112 |
Physicochemical Properties
| Residues | 44 |
|---|---|
| Sequence | QWGYNSYGYGNYGGYGGYPMYGGYGMNGGYGGGGLLGMFLGKKK |
| Molecular Weight | 4619.088 |
| Grand Average of Hydropathy | -0.636 |
| Isoelectric Point | 9.305 |
| Charge at pH 7.4 | 2.527 |
| Secondary Structure | Helix: 0.318, Turn: 0.523, Sheet: 0.136 |
| Instability Index | 1.161 |
| Aromaticity | 0.25 |