| ID | DRAMP03796 |
|---|---|
| Sequence | NPANPLNLKKHHGVFCDVCKALVEGGEKVGDDDLDAWLDVNIGTLCWTMLLPLHHECEEELKKVKKELKKDIENKDSPDKACKDVDLC |
| Length | 88 |
| Name | T07C4.4 (SPP-1; saposin-like protein, SAPLIP; roundworm, nematoda, animals) |
| Source | Caenorhabditis elegans |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9920402 |
Physicochemical Properties
| Residues | 88 |
|---|---|
| Sequence | NPANPLNLKKHHGVFCDVCKALVEGGEKVGDDDLDAWLDVNIGTLCWTMLLPLHHECEEELKKVKKELKKDIENKDSPDKACKDVDLC |
| Molecular Weight | 9897.283 |
| Grand Average of Hydropathy | -0.557 |
| Isoelectric Point | 5.086 |
| Charge at pH 7.4 | -6.462 |
| Secondary Structure | Helix: 0.273, Turn: 0.170, Sheet: 0.284 |
| Instability Index | 44.194 |
| Aromaticity | 0.034 |