| ID | DRAMP04490 |
|---|---|
| Sequence | SYREAVLRAVDQFNERSAEANLYRLLELDPPPEQDAEDRGARKPVSFKVKETVCPRTSQQPVEQCD |
| Length | 66 |
| Name | Myeloid antimicrobial peptide |
| Source | Ovis aries (Sheep) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P79360 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8549789 |
Physicochemical Properties
| Residues | 66 |
|---|---|
| Sequence | SYREAVLRAVDQFNERSAEANLYRLLELDPPPEQDAEDRGARKPVSFKVKETVCPRTSQQPVEQCD |
| Molecular Weight | 7577.313 |
| Grand Average of Hydropathy | -0.982 |
| Isoelectric Point | 4.902 |
| Charge at pH 7.4 | -3.796 |
| Secondary Structure | Helix: 0.227, Turn: 0.197, Sheet: 0.288 |
| Instability Index | 40.308 |
| Aromaticity | 0.061 |
