| ID | DRAMP04527 |
|---|---|
| Sequence | SVRTQDNAVNRQIFGSNGPYRDFQLSDCYLPLETNPYCNEWQFAYHWNNALMDCERAIYHGCNRTRNNFITLTACKNQAGPICNRRRH |
| Length | 88 |
| Name | Luxuriosin |
| Source | Acalolepta luxuriosa (longicorn beetle) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15716136 |
Physicochemical Properties
| Residues | 88 |
|---|---|
| Sequence | SVRTQDNAVNRQIFGSNGPYRDFQLSDCYLPLETNPYCNEWQFAYHWNNALMDCERAIYHGCNRTRNNFITLTACKNQAGPICNRRRH |
| Molecular Weight | 10374.445 |
| Grand Average of Hydropathy | -0.863 |
| Isoelectric Point | 8.625 |
| Charge at pH 7.4 | 2.206 |
| Secondary Structure | Helix: 0.250, Turn: 0.261, Sheet: 0.170 |
| Instability Index | 28.248 |
| Aromaticity | 0.125 |
