Basic Information
| ID | DRAMP04700 |
|---|
| Sequence | DLWQFGKMILKVAGKLPFPYYGAYGCYCGWGGRGKPKDPTDRCCFVHDCC |
|---|
| Length | 50 |
|---|
| Name | Basic phospholipase A2 BnpTX-1 (BnPTx-I, svPLA2; Phosphatidylcholine 2-acylhydrolase) |
|---|
| Source | Bothrops pauloensis (Neuwied's lancehead) (Bothrops neuwiedipauloensis) |
|---|
| Activity | Antimicrobial, Antibacterial, Antiparasitic, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | Gram-negative bacterium: E. coli ATCC29648 and Gram-positive bacterium: S. aureus ATCC 25923. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P0DM51 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 15302537 |
|---|
