| ID | DRAMP18250 |
|---|---|
| Sequence | MACQCPDAISGWTHTDYQCHGLENKMYRHVYAICMNGTQVYCRTEWGSSC |
| Length | 50 |
| Name | Laterosporulin (Bacteriocin) |
| Source | Brevibacillus sp. Strain GI-9 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive, Gram-negative (broad spectrum) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | H1ZZ98 |
| PDB | 4OZK resolved by X-ray |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 22403615, 25345978 |
Physicochemical Properties
| Residues | 50 |
|---|---|
| Sequence | MACQCPDAISGWTHTDYQCHGLENKMYRHVYAICMNGTQVYCRTEWGSSC |
| Molecular Weight | 5750.467 |
| Grand Average of Hydropathy | -0.442 |
| Isoelectric Point | 6.216 |
| Charge at pH 7.4 | -1.762 |
| Secondary Structure | Helix: 0.220, Turn: 0.200, Sheet: 0.180 |
| Instability Index | 47.402 |
| Aromaticity | 0.12 |