| ID | DRAMP18256 |
|---|---|
| Sequence | GLCAVNEFVALAAIPGGAATFAVCQMPNLDEIVSNAAYV |
| Length | 39 |
| Name | Boticin B (Bacteriocin) |
| Source | Clostridium botulinum |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q9KGZ4 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11097932 |
Physicochemical Properties
| Residues | 39 |
|---|---|
| Sequence | GLCAVNEFVALAAIPGGAATFAVCQMPNLDEIVSNAAYV |
| Molecular Weight | 3911.48 |
| Grand Average of Hydropathy | 0.985 |
| Isoelectric Point | 4.05 |
| Charge at pH 7.4 | -3.491 |
| Secondary Structure | Helix: 0.333, Turn: 0.231, Sheet: 0.385 |
| Instability Index | 25.251 |
| Aromaticity | 0.077 |