| ID | DRAMP18258 |
|---|---|
| Sequence | PNWTKIGKCAGSIAWAIGSGLFGGAKLIKIKKYIAELGGLQKAAKLLVGATTWEEKLHAGGYALINLAAELTGVAGIQANCF |
| Length | 82 |
| Name | Closticin 574(Bacteriocin) |
| Source | Clostridium tyrobutyricum ADRIAT 932 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive(narrow) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8GCU9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12620847 |
Physicochemical Properties
| Residues | 82 |
|---|---|
| Sequence | PNWTKIGKCAGSIAWAIGSGLFGGAKLIKIKKYIAELGGLQKAAKLLVGATTWEEKLHAGGYALINLAAELTGVAGIQANCF |
| Molecular Weight | 8456.879 |
| Grand Average of Hydropathy | 0.389 |
| Isoelectric Point | 9.483 |
| Charge at pH 7.4 | 4.866 |
| Secondary Structure | Helix: 0.329, Turn: 0.232, Sheet: 0.341 |
| Instability Index | 3.622 |
| Aromaticity | 0.085 |