| ID | DRAMP18277 |
|---|---|
| Sequence | DIDITGCSACKYAAGQVCTIGCSAAGGFICGLLGITIPVAGLSCLGFVEIVCTVADEYSGCGDAVAKEACNRAGLC |
| Length | 76 |
| Name | Halocin C8 (Bacteriocin) |
| Source | Halobacterium sp. (strain AS7092) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P83716 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12811620, 15978083 |
Physicochemical Properties
| Residues | 76 |
|---|---|
| Sequence | DIDITGCSACKYAAGQVCTIGCSAAGGFICGLLGITIPVAGLSCLGFVEIVCTVADEYSGCGDAVAKEACNRAGLC |
| Molecular Weight | 7441.582 |
| Grand Average of Hydropathy | 0.886 |
| Isoelectric Point | 4.143 |
| Charge at pH 7.4 | -4.692 |
| Secondary Structure | Helix: 0.289, Turn: 0.237, Sheet: 0.250 |
| Instability Index | 40.803 |
| Aromaticity | 0.053 |
