Basic Information
| ID | DRAMP18308 |
|---|
| Sequence | MGISSPALPQNTADLFQLDLEIGVEQSLASPAITSVSWCTPGCTSEGGGSGCSHCC |
|---|
| Length | 56 |
|---|
| Name | Planosporicin(Bacteriocin) |
|---|
| Source | Planomonospora alba |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | broad-spectrum |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
R4ZCJ5 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 17469849 |
|---|
Physicochemical Properties
| Residues | 56 |
|---|
| Sequence | MGISSPALPQNTADLFQLDLEIGVEQSLASPAITSVSWCTPGCTSEGGGSGCSHCC |
|---|
| Molecular Weight | 5615.221 |
|---|
| Grand Average of Hydropathy | 0.187 |
|---|
| Isoelectric Point | 4.05 |
|---|
| Charge at pH 7.4 | -5.797 |
|---|
| Secondary Structure | Helix: 0.214, Turn: 0.375, Sheet: 0.232 |
|---|
| Instability Index | 72.377 |
|---|
| Aromaticity | 0.036 |
|---|
Similar Structure Search
File for ID DRAMP18308 does not exist.
