| ID | DRAMP18332 |
|---|---|
| Sequence | GTTVVNSTFSIVLGNKGYICTVTVECMRNCQ |
| Length | 31 |
| Name | BHT-Aa(Bacteriocin) |
| Source | Streptococcus rattus BHT |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16194596, 18220976 |
Physicochemical Properties
| Residues | 31 |
|---|---|
| Sequence | GTTVVNSTFSIVLGNKGYICTVTVECMRNCQ |
| Molecular Weight | 3338.852 |
| Grand Average of Hydropathy | 0.403 |
| Isoelectric Point | 7.949 |
| Charge at pH 7.4 | 0.48 |
| Secondary Structure | Helix: 0.323, Turn: 0.258, Sheet: 0.097 |
| Instability Index | 38.258 |
| Aromaticity | 0.065 |