Basic Information
| ID | DRAMP18365 |
|---|
| Sequence | INTWNTTATSTSIIISETFGNKGKVCTYTVECVNNCRG |
|---|
| Length | 38 |
|---|
| Name | Thusin (ThsA1, ThsA2; a two-chain lantibiotic, type 2, class 1 bacteriocins) |
|---|
| Source | Bacillus thuringiensis strain BGSC 4BT1, serovar rongseni |
|---|
| Activity | Antimicrobial, Antibacterial |
|---|
| Pathogen | Active against S. pneumoniae ATCC 49619, B. cereus ATCC 14579, B. thuringiensis BMB171, B. pumilus SCG I , B. subtilis Bsn5, L. monocytogenes LM201 (MIC 6.25 uM), L. monocytogenes LM605, S. aureus ATCC 43300, S. sciuri Bom1, B. amyloliquefaciens X1 (MIC 12.5 uM), S. aureus CMCC 26003, MRSA (MIC 25 uM), and E. faecalis ATCC 29212 (MIC 50 uM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 27486447 |
|---|
