| ID | DRAMP18394 |
|---|---|
| Sequence | RLNTTFRPLNFKMLRFWGQNRNIMKHRGQKVHFSLILSDCKTNKDCPKLRRANVRCRKSYCVPI |
| Length | 64 |
| Name | NCR335 (nodule-specific cysteine-rich peptides; plants) |
| Source | Medicago truncatula |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | Active against S. enterica (MIC 16 uM) and L. monocytogenes (MIC 32 uM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | [Ref.28167938]No cytotoxicity information found |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 28167938 |
Physicochemical Properties
| Residues | 64 |
|---|---|
| Sequence | RLNTTFRPLNFKMLRFWGQNRNIMKHRGQKVHFSLILSDCKTNKDCPKLRRANVRCRKSYCVPI |
| Molecular Weight | 7736.143 |
| Grand Average of Hydropathy | -0.716 |
| Isoelectric Point | 11.274 |
| Charge at pH 7.4 | 13.513 |
| Secondary Structure | Helix: 0.281, Turn: 0.219, Sheet: 0.141 |
| Instability Index | 39.595 |
| Aromaticity | 0.094 |