| ID | DRAMP18407 |
|---|---|
| Sequence | KEICCKVPTTPFLCTNDPQCKTLCSKVNYEDGHCFDILSKCVCMNRCVQDAKTLAAELIEEEFLKQ |
| Length | 66 |
| Name | Thionin-like peptide 1 (plants) |
| Source | Fruits, Capsicum annuum |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | Active against S. cerevisiae, C. albicans, C. tropicalis, E. coli and P. aeruginosa. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 23896704 |
Physicochemical Properties
| Residues | 66 |
|---|---|
| Sequence | KEICCKVPTTPFLCTNDPQCKTLCSKVNYEDGHCFDILSKCVCMNRCVQDAKTLAAELIEEEFLKQ |
| Molecular Weight | 7490.699 |
| Grand Average of Hydropathy | -0.171 |
| Isoelectric Point | 5.216 |
| Charge at pH 7.4 | -2.638 |
| Secondary Structure | Helix: 0.258, Turn: 0.136, Sheet: 0.242 |
| Instability Index | 51.436 |
| Aromaticity | 0.061 |