Basic Information
| ID | DRAMP20807 |
| Sequence | PPPVIKFNRPFLMWIVERDTRSILFMGKIVNPKAP |
| Length | 35 |
| Name | A1P394-428 |
| Source | American alligator |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | [Ref.27542832] Gram-positive bacteria:Staphylococcus aureus ATCC BAA-1718 (EC50=36.5μg/ml), Staphylococcus aureus ATCC 33592 (EC50=2.68μg/ml);##Gram-negative bacteria:Escherichia coli ATCC 4157 (EC50=9.2μg/ml), Escherichia coli ATCC 51659 (EC50=2.51μg/ml), Pseudomonas aeruginosa PAO1 (EC50=38.6μg/ml), Acinetobacter baumannii ATCC 9955 (EC50=24.0μg/ml), Acinetobacter baumannii ATCC BAA-1794 (EC50=2.36μg/ml) |
| Hemolytic Activity | [Ref.27542832] Not hemolytic to sheep red blood cells. |
| Cytotoxicity | [Ref.27542832] The cell proliferation of A549 human lung epithelial cells is 170%, 180%, 182%, 180% and 180% at peptide concentrations of 1 μg/ml, 10 μg/ml, 25 μg/ml, 50 μg/ml, 100 μg/ml |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Linear/Cyclic/Branched | Linear |
| Uniprot |
|
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 27542832 |
|---|