| ID | DRAMP20862 |
|---|---|
| Sequence | RRGKDSGGPKMGRKNSKGGWRGRPGSGRPGFGSGI |
| Length | 35 |
| Name | rtCATH2(5-40) |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | [Ref.27818338]Gram-negative bacteria:Escherichia coli (ATCC 25922)(MIC=16μM);A. salmonicida (ATCC 33658)(MIC=16μM);Y. ruckeri (NCIMB 1315)(MIC=16μM);##Gram-positive bacteria:Staphylococcus aureus (ATCC 25923)(MIC=64μM) |
| Hemolytic Activity | [Ref.27818338] No hemolytic activity to human |
| Cytotoxicity | [Ref.27818338] No cytotoxicity information found |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Linear/Cyclic/Branched | Linear |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 27818338 |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | RRGKDSGGPKMGRKNSKGGWRGRPGSGRPGFGSGI |
| Molecular Weight | 3599.016 |
| Grand Average of Hydropathy | -1.546 |
| Isoelectric Point | 12 |
| Charge at pH 7.4 | 8.548 |
| Secondary Structure | Helix: 0.086, Turn: 0.571, Sheet: 0.029 |
| Instability Index | 50.351 |
| Aromaticity | 0.057 |