Basic Information
| ID | DRAMP20863 |
| Sequence | KIRTRRGKDSGGPKMGRKNSKGGWRGRPGSGSRPGFGSGI |
| Length | 40 |
| Name | rtCATH2(1-40) |
| Source | Synthetic construct |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | [Ref.27818338]Gram-negative bacteria:Escherichia coli (ATCC 25922)(MIC=4μM);A. salmonicida (ATCC 33658)(MIC=8-4μM);Y. ruckeri (NCIMB 1315)(MIC=16μM);V. anguillarum (ATCC 43305 With addition of 2% NaCl)(MIC>32μM);A. hydrophila (ATCC 7966)(MIC>32μM);##Gram-positive bacteria:Staphylococcus aureus (ATCC 25923)(MIC=16-8μM);L. garvieae (ATCC 49156)(MIC=16-8μM) |
| Hemolytic Activity | [Ref.27818338] No hemolytic activity to human;No hemolytic activity to trout |
| Cytotoxicity | [Ref.27818338] The cell viability of RTG-2 cells is 112.5%, 105%, 107%, 94% at peptide concentrations of 0.25, 1, 4, and 8 μM. |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Linear/Cyclic/Branched | Linear |
| Uniprot |
|
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 27818338 |
|---|