| ID | dbAMP11406 |
|---|---|
| Sequence | TDTNVIGECFDEWSRCHRQTRWWTKILFQSCENRCKCKVQLMGNCIKVPFKCFLWKQKRFMCECYGPISGTKPWYCGWEL |
| Length | 80 |
| Name | Mytimacin-AF |
| Source | |
| Activity | Antibacterial |
| Pathogen | Staphylococcus aureus ATCC 25923 (MIC=1.9µg/ml)&&RBCs Source of Human (3.9% hemolysis at 320µg/ml)&&RBCs Source of Human (3.2% hemolysis at 160µg/ml)&&RBCs Source of Human (2.4% hemolysis at 40µg/ml)&&RBCs Source of Human (2.3% hemolysis at 80µg/ml)&&RBCs |
| Hemolytic Activity | Not included yet |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 23103587, 23103587, 23103587, 23103587, 23103587, 23103587, 23103587, 23103587, 23103587 |
Physicochemical Properties
| Residues | 80 |
|---|---|
| Sequence | TDTNVIGECFDEWSRCHRQTRWWTKILFQSCENRCKCKVQLMGNCIKVPFKCFLWKQKRFMCECYGPISGTKPWYCGWEL |
| Molecular Weight | 9711.334 |
| Grand Average of Hydropathy | -0.475 |
| Isoelectric Point | 8.878 |
| Charge at pH 7.4 | 4.981 |
| Secondary Structure | Helix: 0.300, Turn: 0.175, Sheet: 0.138 |
| Instability Index | 47.347 |
| Aromaticity | 0.163 |
