| ID | dbAMP28336 |
|---|---|
| Sequence | MLSLSDAVQLMLGFGTFVLMLLGLVVELIKNSNKK |
| Length | 35 |
| Name | T1RM4 |
| Source | |
| Activity | Antibacterial |
| Pathogen | RBCs Source of Sheep (0% hemolysis at 50µM(non-hemolytic)) |
| Hemolytic Activity | Not included yet |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 20927512 |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | MLSLSDAVQLMLGFGTFVLMLLGLVVELIKNSNKK |
| Molecular Weight | 3823.671 |
| Grand Average of Hydropathy | 1.003 |
| Isoelectric Point | 8.255 |
| Charge at pH 7.4 | 0.279 |
| Secondary Structure | Helix: 0.457, Turn: 0.229, Sheet: 0.400 |
| Instability Index | 15.154 |
| Aromaticity | 0.057 |