| ID | DRAMP00018 |
|---|---|
| Sequence | GTTVVNSTFSIVLGNKGYICTVTVECMRNCSK |
| Length | 32 |
| Name | SmbA1 (Bacteriocin) |
| Source | Streptococcus mutans GS5 (Gram-negative bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15673730 |
Physicochemical Properties
| Residues | 32 |
|---|---|
| Sequence | GTTVVNSTFSIVLGNKGYICTVTVECMRNCSK |
| Molecular Weight | 3425.972 |
| Grand Average of Hydropathy | 0.353 |
| Isoelectric Point | 8.656 |
| Charge at pH 7.4 | 1.478 |
| Secondary Structure | Helix: 0.312, Turn: 0.281, Sheet: 0.094 |
| Instability Index | 39.731 |
| Aromaticity | 0.062 |