| ID | DRAMP00025 |
|---|---|
| Sequence | TTPVCAVAATAAASSAACGWVGGGIFTGVTVVVSLKHC |
| Length | 38 |
| Name | CylLL (a structural subunit of cytolysin; Bacteriocin) |
| Source | Enterococcus faecalis (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 8898386 |
Physicochemical Properties
| Residues | 38 |
|---|---|
| Sequence | TTPVCAVAATAAASSAACGWVGGGIFTGVTVVVSLKHC |
| Molecular Weight | 3564.118 |
| Grand Average of Hydropathy | 1.182 |
| Isoelectric Point | 7.679 |
| Charge at pH 7.4 | 0.169 |
| Secondary Structure | Helix: 0.289, Turn: 0.237, Sheet: 0.237 |
| Instability Index | 27.774 |
| Aromaticity | 0.053 |
