| ID | DRAMP00167 |
|---|---|
| Sequence | NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG |
| Length | 35 |
| Name | Subtilosin A (Antilisterial bacteriocin subtilosin; D-amino acid; Bacteriocin; Preclinical) |
| Source | Bacillus subtilis (strain 168) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | [Ref.17213266] MICs between 1 and 12.5 mg/L: E. faecalis OGX-1, L. monocytogenes ATCC 19115, P. gingivalis ATCC 33277, K. rhizophila ATCC 9341, Enterobacter aerogenes ATCC 13408, Streptococcus pyogenes ATCC 19615 and Shigella sonnei ATCC 25931. ##MICs between 25 and 100 mg/L: Escherichia coli ATCC 8739, Pseudomonas aeruginosa ATCC 9027, S. gordonii Challis ATCC 49818 and Staphylococcus aureus ATCC 6538. ##MICs over 100mg/L: B. subtilis ATCC 6633,Fusobacterium nucleatum ATCC 25586,P. gingivalis W83 ,K. pneumoniae ATCC 4352 ,K. pneumoniae UMN1, Bacillus cereus ATCC 10876, Staphylococcus epidermidis ATCC 12228,Proteus mirabilis ATCC 25933 ,Salmonella enterica Typhi ATCC 12048. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | No specific N-terminal |
| C-terminal Modification | No specific C-terminal |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot | O07623 |
| PDB | 1PXQ |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 3936839, 15035610 |
Physicochemical Properties
| Residues | 35 |
|---|---|
| Sequence | NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG |
| Molecular Weight | 3425.906 |
| Grand Average of Hydropathy | 0.691 |
| Isoelectric Point | 4.05 |
| Charge at pH 7.4 | -2.517 |
| Secondary Structure | Helix: 0.286, Turn: 0.314, Sheet: 0.257 |
| Instability Index | 24.714 |
| Aromaticity | 0.086 |