| ID | DRAMP00048 |
|---|---|
| Sequence | WKSESLCTPGCVTGALQTCFLQTLTCNCKISK |
| Length | 32 |
| Name | Lantibiotic subtilin (Bacteriocin) |
| Source | Bacillus subtilis (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | Succinylation |
| C-terminal Modification | Free |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot | P10946 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 4154277, 21239550 |
Physicochemical Properties
| Residues | 32 |
|---|---|
| Sequence | WKSESLCTPGCVTGALQTCFLQTLTCNCKISK |
| Molecular Weight | 3465.072 |
| Grand Average of Hydropathy | 0.191 |
| Isoelectric Point | 8.415 |
| Charge at pH 7.4 | 1.429 |
| Secondary Structure | Helix: 0.250, Turn: 0.219, Sheet: 0.188 |
| Instability Index | 38.419 |
| Aromaticity | 0.062 |