| ID | DRAMP00064 |
|---|---|
| Sequence | MSKRDCNLMKACCAGQAVTYAIHSLLNRLGGDSSDPAGCNDIVRKYCK |
| Length | 48 |
| Name | Enterocin 96 (Bacteriocin) |
| Source | Enterococcus faecalis (strain ATCC 700802 / V583) (Gram-positive bacteria) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive bacteria: Enterococcus faecalis, E. faecium WHE, E. hirae, E. pseudoavium, E. sulfureus, E. saccharolyticus, E. columbae, Lactobacillus plantarum, L. acidophilus, Lactobacillus sakeii subsp. sakei, L. paracasei subsp. paracasei, Lactococcus lactis, Lactococcus lactis subsp. cremoris, Leuconostoc mesenteroides, Bacillus subtilis, Bacillus cereus, Listeria innocua, Listeria monocytogenes, Staphylococcus xylosus, Staphylococcus aureus;##Gram-negative bacteria: Salmonella enterica serovar Typhimurium, S. enterica serovar Infantis, Klebsiella pneumoniae, Serratia liquefaciens, Proteus vulgaris, Enterobacter cloacae, Escherichia coli. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q82YI9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12663927 |
Physicochemical Properties
| Residues | 48 |
|---|---|
| Sequence | MSKRDCNLMKACCAGQAVTYAIHSLLNRLGGDSSDPAGCNDIVRKYCK |
| Molecular Weight | 5178.971 |
| Grand Average of Hydropathy | -0.252 |
| Isoelectric Point | 8.72 |
| Charge at pH 7.4 | 2.186 |
| Secondary Structure | Helix: 0.208, Turn: 0.250, Sheet: 0.229 |
| Instability Index | 53.467 |
| Aromaticity | 0.042 |